PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001522-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 130aa    MW: 15074.7 Da    PI: 10.4684
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001522-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.62.9e-171150342
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                        i n+s r+ tf kR++g+lKK +ELS+LC+++ + ii+s+
  WALNUT_00001522-RA 11 IANDSARKATFKKRKKGLLKKMSELSTLCAVQTCAIIYSP 50
                        89*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.9E-20160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.301149IPR002100Transcription factor, MADS-box
CDDcd002667.06E-19285No hitNo description
SuperFamilySSF554554.19E-23295IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-8323IPR002100Transcription factor, MADS-box
PfamPF003193.1E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004049.5E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MTRKKVNFAY IANDSARKAT FKKRKKGLLK KMSELSTLCA VQTCAIIYSP YDPEPEVWPS  60
PLGAQSVIAR FKSMSKAEQS RKMVNQESFL GQRITKSEEL LMKQHIENRE SEMTQVMYRS  120
LVMLVFLVYR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVNFAYIANDSARKATFKKRK
22125KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006382260.12e-57hypothetical protein POPTR_0005s00420g
SwissprotQ9FJK33e-42AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLU5GF693e-57U5GF69_POPTR; Uncharacterized protein
STRINGPOPTR_0005s00420.13e-58(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-38AGAMOUS-like 80